DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP009828

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_318940.4 Gene:AgaP_AGAP009828 / 1279246 VectorBaseID:AGAP009828 Length:232 Species:Anopheles gambiae


Alignment Length:229 Identity:63/229 - (27%)
Similarity:98/229 - (42%) Gaps:23/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            |::||:.....|:.:..|.||....::|..|...:.||:.|.:..|.....|..|.|     .|.
Mosquito    19 PYIVAIKTTSASTLLCAGVLIKTTWILTTAQCVNDKTAADLKILTGSHRLLTSKELL-----LIS 78

  Fly   184 SIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYM 248
            .|.|||.:...:...|:||:.|..:::.|..:..:.:...| .......:|.|||.:|:...:|.
Mosquito    79 KIERHPSYKPASSEYNLALLQLSAAVSLSSRVATVVLNDEP-IISGIPVVFFGWGASSYGSLAYS 142

  Fly   249 NVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRY 313
            |||:.:....:....|..|..|.   |...||  :|..|:||:.:|..|...||.        ||
Mosquito   143 NVLQSLYKRTLSTSDCRAQSGLV---DLSADN--ICTIGQPGQAACTHDEAGPLV--------RY 194

  Fly   314 E---LAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :   |.|:.|:|..| ....|.|:.||.....||
Mosquito   195 DTQKLVGLFNYGSQC-TGRSPDVFVNVLTHKTWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 61/227 (27%)
Tryp_SPc 113..344 CDD:238113 61/227 (27%)
AgaP_AGAP009828XP_318940.4 Tryp_SPc 7..230 CDD:238113 63/229 (28%)
Tryp_SPc 7..227 CDD:214473 61/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.