DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP007795

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_317712.4 Gene:AgaP_AGAP007795 / 1278167 VectorBaseID:AGAP007795 Length:319 Species:Anopheles gambiae


Alignment Length:273 Identity:79/273 - (28%)
Similarity:114/273 - (41%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLDAR---TSSYVAGGALIAPHVVITARQRTE-----NMTASQLVVRAGEWDFSTKTE 173
            :.||.|||....   |.||..||.::...|||||.....     .:.|.:|.||.|.:|..|...
Mosquito    51 QFPWHVALYRTEQPLTISYACGGFIVGERVVITAAHCVTAPSGYQLAADELTVRVGLYDLLTLAR 115

  Fly   174 QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRC-IFTGW 237
            .  |.:..:..|.||..|...:..:::||:.||..:.....:.|||:|..|......|. ..:||
Mosquito   116 H--SQEHRVGRIHRHGNFTTGSLRHDLALLMLRTIVEFGDFVQPICLPREPDALKGVRTGTVSGW 178

  Fly   238 GKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPL 302
            |....|.|:  ..|:..::|||...:|.|.....:|.  .|.:.:.|||.|.|.:.|.||.|...
Mosquito   179 GLVEDDSPA--RTLRSATMPVVSYLSCLQSDSTLFGP--VLYDGMFCAGWENGTNVCNGDSGGAF 239

  Fly   303 ACAIKDNPQRYELAGIVNF-GVD----------------CGLPGVPAVYTN----VANVIEWITL 346
            |..:..:   :...|||:| ||.                .|...:| :|.|    || .:|.:.|
Mosquito   240 AANVNGS---WTAFGIVSFTGVREHTDGQTPFRCDTKSLAGFISIP-MYLNWIESVA-AVEAVQL 299

  Fly   347 TT----VNMPLPE 355
            .|    .|.|||:
Mosquito   300 DTHREMPNSPLPK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/256 (29%)
Tryp_SPc 113..344 CDD:238113 73/256 (29%)
AgaP_AGAP007795XP_317712.4 Tryp_SPc 41..291 CDD:238113 70/249 (28%)
Tryp_SPc 41..288 CDD:214473 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.