DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:236 Identity:72/236 - (30%)
Similarity:118/236 - (50%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDV 180
            ||.|:.|:|  .|:..::.||::::...::||...|:....:.|.||.|    |::.....|| :
Mosquito    58 AETPYQVSL--QRSKRHICGGSVLSGKWILTAAHCTDGSQPASLTVRLG----SSRHASGGSV-I 115

  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWG--KNSF 242
            .:..||:||.::.|....:.:|:.|...||.|..:.||.:|...:.. |....|.:|||  |::.
Mosquito   116 HVARIVQHPDYDQETIDYDYSLLELESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWGSTKSAI 180

  Fly   243 DDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAI 306
            :..:   :|:..::|.|.:..|.|.    |.....:...::||| .:.|||:|:||.|.||....
Mosquito   181 ESNA---ILRAANVPTVNQDECNQA----YHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAED 238

  Fly   307 KDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLT 347
            |       |.|:|::|..|..||.|.||..||.|.:||..|
Mosquito   239 K-------LIGVVSWGAGCAQPGYPGVYARVAVVRDWIRET 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/231 (30%)
Tryp_SPc 113..344 CDD:238113 69/231 (30%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 69/231 (30%)
Tryp_SPc 49..272 CDD:238113 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.