DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and TRY7_ANOGA

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_317172.2 Gene:TRY7_ANOGA / 1277689 VectorBaseID:AGAP008293 Length:267 Species:Anopheles gambiae


Alignment Length:231 Identity:71/231 - (30%)
Similarity:116/231 - (50%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDV 180
            ::.|:.|:|  ...:|:..||:::....|:||...|:.:.|..|.||.|    |::.....:| |
Mosquito    51 SDTPYQVSL--QYINSHRCGGSVLNSKWVLTAAHCTDGLQAFTLTVRLG----SSRHASSGTV-V 108

  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSFDD 244
            .:..||.||.:|..|...:.||:.|...||.|..:.|:.:|...:..|. :..|.:|||......
Mosquito   109 NVARIVEHPKYNEYNTDYDYALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWGSTKSAT 173

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKD 308
            .|.. :|:..::|.|.:..|.:.    |.:| .:.:.::||| .:.|||:|:||.|.||   :.|
Mosquito   174 ESNA-ILRAANVPTVDQEECREA----YSHD-AITDRMLCAGYQQGGKDACQGDSGGPL---VAD 229

  Fly   309 NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .    :|.|:|::|..|..||.|.||..||.|..|:
Mosquito   230 G----KLIGVVSWGSGCAQPGYPGVYARVAVVRNWV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 70/229 (31%)
Tryp_SPc 113..344 CDD:238113 70/229 (31%)
TRY7_ANOGAXP_317172.2 Tryp_SPc 41..261 CDD:214473 70/229 (31%)
Tryp_SPc 42..264 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.