DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:239 Identity:63/239 - (26%)
Similarity:101/239 - (42%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALL--DARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQ- 174
            |:..:.|:.|.|.  .......:.||:|:....|:||....  |.|..:.|..|..|||..|.. 
Mosquito    34 AKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWVLTAGHCV--MLAKSVEVHLGAVDFSDNTNDG 96

  Fly   175 ---LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTG 236
               |.|.:     ..:|..:|....||:||||.|...:..|..:.|:.:|:..::|.....:.:|
Mosquito    97 RLVLESTE-----FFKHEKYNPLFVANDVALVKLPSKVEFSERVQPVRLPTGDEDFAGREVVVSG 156

  Fly   237 WGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSP 301
            ||. ..:.......|:..:|.|:..:.|::..     :...:..|.:||.||..:..|.||.|.|
Mosquito   157 WGL-MVNGGQVAQELQYATLKVIPNKQCQKTF-----SPLLVRKSTLCAVGEELRSPCNGDSGGP 215

  Fly   302 LACAIKDNPQRYELAGIVNFGVDCGL-PGVPAVYTNVANVIEWI 344
            |..|     :...|.|:|:||...|. .|.||.:..|....:|:
Mosquito   216 LVLA-----EDKTLVGVVSFGHAQGCDKGHPAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/237 (26%)
Tryp_SPc 113..344 CDD:238113 62/237 (26%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 62/237 (26%)
Tryp_SPc 28..257 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.