DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:368 Identity:77/368 - (20%)
Similarity:138/368 - (37%) Gaps:109/368 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGIIAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAI 69
            :.::|..:|:|:.|||.:...:                ||     .:::.:..|...    :.||
Mosquito     4 FTVLAATALLLLLGQVSSTPVD----------------PR-----SVDWSVVRTLHQ----TDAI 43

  Fly    70 CCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSY-V 133
            ...:.|          .|:||.|         ..|.|..|..:|...:.||.|.:|.:.:||: .
Mosquito    44 RAKQGL----------APLTDDQ---------VRSSRISDGQIATATQFPWAVGVLISGSSSHSF 89

  Fly   134 AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGAN 198
            ..|.||:|..|:||......  ::.|.:..|..|. |:.|:.    :.:.:|:.||.::.....:
Mosquito    90 CSGVLISPRFVLTAAVCISG--SNTLTILLGASDM-TRVEEF----IGVSNILSHPNYSSFFNRD 147

  Fly   199 NVALVFLRRSLTSSRHINPICMP---SAPKNFDFSRCIFTGWGKNS--FDDPSYMNVLKKISLPV 258
            ::|::.|.........|.||.:|   ....||:.......|||...  .::|        |.:| 
Mosquito   148 DIAILTLSSPAPIRNTIRPIDLPRWSDVGNNFNNWAATTAGWGNTGRRENEP--------IPIP- 203

  Fly   259 VQRRTCEQQLRLYYGNDFELDNSLMCA----------------GGEPGKDSCEGDGGSPLACAIK 307
                      .|::..| .::::.:|.                .|.|    |.||.|.|:  .:.
Mosquito   204 ----------NLHFAVD-SVNSNFVCGLSHTFIRDTHICTSTDNGGP----CNGDEGGPV--TVT 251

  Fly   308 DNPQRYELAGIVN------FGVDCGLPGVPAVYTNVANVIEWI 344
            ::.:.: |.||.:      ||.|   .|..||:|.:...:.||
Mosquito   252 ESGRTF-LVGIHSFHYSGLFGCD---RGRSAVHTRITEYLGWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 56/258 (22%)
Tryp_SPc 113..344 CDD:238113 56/258 (22%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 58/265 (22%)
Tryp_SPc 62..293 CDD:238113 59/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.