DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005670

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_315687.1 Gene:AgaP_AGAP005670 / 1276350 VectorBaseID:AGAP005670 Length:300 Species:Anopheles gambiae


Alignment Length:261 Identity:73/261 - (27%)
Similarity:112/261 - (42%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QEA---EVPWMVALL-DARTSSYVAGGA-------LIAPHVVIT-----ARQRTENMTA------ 156
            |||   :.|:.:||| :..|.:.:.||:       |.|.|.|::     ||..|..|.|      
Mosquito    59 QEATPGQFPYQIALLSEFLTGTGLCGGSVLTNNYILTAAHCVVSGATTLARGGTAIMGAHNRNVN 123

  Fly   157 --SQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPIC 219
              ||..:|     |||            ..|:|||.:...|..|::|:|.|...:..:..:.|..
Mosquito   124 EPSQQRIR-----FST------------GGIIRHPQYTTTNIRNDIAVVRLDAPIVFNTRVQPAR 171

  Fly   220 MPSAPKNFDFSRCIFT----GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDN 280
            :|:......|..  ||    |:|:.|....:...|::..|.||:....|     :...|...:..
Mosquito   172 LPARSDTRQFGG--FTGTVSGFGRVSDGSTATSAVVRFTSNPVMTNADC-----IARWNTALIQP 229

  Fly   281 SLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGV--DCGLPGVPAVYTNVANVIEW 343
            ..:|..||.|:.:|.||.|.||  |::|.....  .|||:||.  .|.: |:|:||..|:..:.|
Mosquito   230 QNVCLSGEGGRSACNGDSGGPL--AVQDGGSLQ--IGIVSFGSAGGCSI-GMPSVYARVSFFLSW 289

  Fly   344 I 344
            |
Mosquito   290 I 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/259 (27%)
Tryp_SPc 113..344 CDD:238113 71/259 (27%)
AgaP_AGAP005670XP_315687.1 Tryp_SPc 54..290 CDD:214473 71/259 (27%)
Tryp_SPc 55..293 CDD:238113 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.