DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:270 Identity:58/270 - (21%)
Similarity:109/270 - (40%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL---LDARTSSYVAGGALIAP-HV 143
            ::.:|:..|......|...|      |..||...:.|:..||   ..:.|..|...|:||.| ::
Mosquito    21 VVLDPVERPSAKIAPSPLAT------DGYLAYPGQFPYHAALRFKTKSSTKVYTCAGSLITPVYI 79

  Fly   144 VITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRS 208
            :.||.....|.......:....::.:|:.||  .:::.:..|..||..:: .|.|::|.:.:...
Mosquito    80 LTTAACVNHNSVEYAFAILGSLFNGNTEWEQ--HINITMNGIRIHPPSSM-YGHNDIATIHMDHP 141

  Fly   209 LTSSRHINPICMP--SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLY 271
            .|.:.::.||.:|  |..:.::    :..|...::.:...    |:.:...|:....|.:.::..
Mosquito   142 ATLNEYVQPIRLPRLSDTRTYE----MMEGTATSALNGDG----LRYLRNQVMSNADCHEAIQPL 198

  Fly   272 YGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTN 336
            |    .:.:..:|.....|...|....||  |..::|...|. |.|:.|..|.|.| ..|..:..
Mosquito   199 Y----NISSQHICTDTYIGGSLCGRTTGS--ALTVEDENGRM-LVGVGNLIVLCDL-HYPIRHIR 255

  Fly   337 VANVIEWITL 346
            |:...|||.|
Mosquito   256 VSYFREWIEL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 49/236 (21%)
Tryp_SPc 113..344 CDD:238113 49/236 (21%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 51/240 (21%)
Tryp_SPc 42..263 CDD:214473 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.