DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP011590

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_309917.4 Gene:AgaP_AGAP011590 / 1271167 VectorBaseID:AGAP011590 Length:354 Species:Anopheles gambiae


Alignment Length:245 Identity:78/245 - (31%)
Similarity:111/245 - (45%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQ-----RTENMTASQLVVRAGEWDFSTK 171
            ||...|.|.||:|...|.|::|.||.||....|:||..     |.:...|||..|...:      
Mosquito    98 LATVGEFPAMVSLQLVRNSAHVCGGTLITMGHVMTAAHCVTNVRGDAQPASQYQVMGDD------ 156

  Fly   172 TEQLPSVDVPIR------SIVRHPGFNLENGANNVALVFLRRSLTSSRHINP-ICMPSAPKNFDF 229
            ...|.::..|:|      ||..||.::.....|:||::.:......:....| ..:..||...| 
Mosquito   157 LYVLQAMASPLRQTRRVSSIHVHPKYDASLFINDVAILRVASEFRKTDTFFPGKRIQKAPIYGD- 220

  Fly   230 SRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
             ||...|||.......:....|.:|::.:....||    ...:||...|  .::||.. ||:|:|
Mosquito   221 -RCSLAGWGVTDEQSRATSPNLLRINVVISDFGTC----NAVFGNLLTL--GMLCAEA-PGRDAC 277

  Fly   295 EGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            :||.|..|.||      ...:||||:||..|..||||.|||:||:..:||
Mosquito   278 QGDSGGALLCA------GGRVAGIVSFGDGCAKPGVPGVYTDVAHYEKWI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 75/242 (31%)
Tryp_SPc 113..344 CDD:238113 75/242 (31%)
AgaP_AGAP011590XP_309917.4 Tryp_SPc 92..321 CDD:214473 76/243 (31%)
Tryp_SPc 93..322 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.