DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP007251

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_308541.4 Gene:AgaP_AGAP007251 / 1269887 VectorBaseID:AGAP007251 Length:313 Species:Anopheles gambiae


Alignment Length:242 Identity:56/242 - (23%)
Similarity:109/242 - (45%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALL-DARTSSYVAGGALIAPHVVITAR-----QRTENMTASQLVVRAGEWDFSTK 171
            |:..:.|:...|| :....:.:.||.::.|:.::||.     .:|...|....::.|........
Mosquito    73 ARVGQFPYQALLLTEFGMFTIMCGGTVLTPNFILTAAHCVMLDQTTKATGGMAILGAHNRMVVES 137

  Fly   172 TEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT- 235
            |:|  .:......|:.||.:...|...:||:|.|...|..:.::.|:.:|:......|...|.| 
Mosquito   138 TQQ--RIRFATSGIIVHPSYTATNFRFDVAMVRLNAPLRFNSYVQPVRLPARTDQRLFDGIIGTV 200

  Fly   236 -GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGG 299
             |:|:.:..|....::|:.....::....|..:    :|: ..::...:|..|:.|:.:|.||.|
Mosquito   201 SGFGRTNDKDGILPSILRYTINTILSNGACAAR----WGS-LLVEPHNICLSGDGGRSACVGDSG 260

  Fly   300 SPLACAIKD-NPQRYELAGIVNFGVDCG-LPGVPAVYTNVANVIEWI 344
            .||  .|:: ....|:: |:.:||...| ..|:|.||..|:..::||
Mosquito   261 GPL--TIEEWGGITYQV-GVTSFGSGNGCTDGMPTVYGRVSYFLDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 54/240 (23%)
Tryp_SPc 113..344 CDD:238113 54/240 (23%)
AgaP_AGAP007251XP_308541.4 Tryp_SPc 66..304 CDD:214473 54/240 (23%)
Tryp_SPc 67..307 CDD:238113 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.