DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:329 Identity:76/329 - (23%)
Similarity:127/329 - (38%) Gaps:53/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVAL----LDARTSSYVAGGALIAPHVVITARQ------RTENMTASQLVVRAGEWDFSTKTE 173
            ||..||    .::|...|..|..::..::||||..      ....:.:..:.:|.|.::.....|
Mosquito    60 PWHAALYHRGFNSRDFEYACGSTIVHRYLVITAAHCVTFATSRRKIPSDNMQLRLGRFNLMNNEE 124

  Fly   174 QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRC-----I 233
            :.......|.:|| |.|:......|::|::.:...:..:.:|.|:|:......||....     .
Mosquito   125 EYAEEFSVIDTIV-HEGYRPTTLENDIAILRVEIPIIFNDYIQPVCLWKRDDGFDLPNVYNQPGT 188

  Fly   234 FTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDG 298
            ..|||.:  ::......|.:..:|||...||....|.::|.  .|.:...|||.:.|...|.||.
Mosquito   189 VVGWGLS--ENNRIGTTLNEAQMPVVNSWTCLASDRAFFGR--FLQSKAFCAGYKNGTGVCNGDS 249

  Fly   299 GSPLACAIKDNPQRYELAGIVNF-GVD-----CGLPGVPAVYTNVANVIEWITLTTVNMPLPEER 357
            |..:....::   |:.|.|||:| .|:     |.|..... :|:.:..|:|:...|     |...
Mosquito   250 GGGMFFQFQN---RWYLKGIVSFSSVNDYSGWCNLRQYIG-FTDASQYIDWVYENT-----PTSG 305

  Fly   358 EEVP-YASPTLSAGPYLNQWNQPNYEWLP----TGYPNVNSIPWQLQ----------EANNDLAN 407
            .:.| ...|.:.   .:||.|....|.:|    ...|.:|..||.:.          ..|..|.|
Mosquito   306 NDDPILGHPNMR---LINQGNCGRNEHMPEMDEDRKPILNQYPWMVALQAKTTTEYVPCNGVLLN 367

  Fly   408 SQYV 411
            ..||
Mosquito   368 RNYV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 57/245 (23%)
Tryp_SPc 113..344 CDD:238113 57/245 (23%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113 58/248 (23%)
Tryp_SPc 50..297 CDD:214473 57/245 (23%)
Tryp_SPc 342..563 CDD:214473 8/30 (27%)
Tryp_SPc 342..563 CDD:304450 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.