DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:286 Identity:69/286 - (24%)
Similarity:115/286 - (40%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGL--------AQEAEV 118
            :|.:..|:|...  ::...||::|:  |..:.|.:|.  :|   .:...||        |..|..
Mosquito     8 VGTIFLALCFTN--VLASDRLVVNK--TVERNGKLNK--IT---HQSKAGLGRIVNGKNANIASY 63

  Fly   119 PWMVALLDARTSSYVAGGALIA-PHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI 182
            |::|.|  ...|:.|.|.::|. .||...|....:|...:.:.:..|      .|.|.....|..
Mosquito    64 PYIVRL--RVNSAGVCGASIITYTHVFTAAHCLYKNQNPASITLYGG------STSQTSGGVVFF 120

  Fly   183 RS-IVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPS 246
            .| ::.||.:|.|....:..:|.::.|....::|.||.:..|....| :.|...|||.|::|..:
Mosquito   121 ASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDAEVPSD-TTCYAAGWGYNNYDRKT 184

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQ 311
            ..:.|:..:|.|:..:.|......|....|      :||......|.|.||.|.|..|..|    
Mosquito   185 SPDNLQYATLQVISPQQCSAAWSGYATPQF------ICAQQNNNGDVCNGDSGGPFVCNDK---- 239

  Fly   312 RYELAGIVNFGVDCGLPGVPAVYTNV 337
               |.|..::|.......:|:.:|.|
Mosquito   240 ---LTGATSYGGVACRGKLPSAFTKV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 57/227 (25%)
Tryp_SPc 113..344 CDD:238113 57/227 (25%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 57/234 (24%)
Tryp_SPc 52..274 CDD:238113 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.