DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP012736

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_307014.4 Gene:AgaP_AGAP012736 / 1268455 VectorBaseID:AGAP012736 Length:340 Species:Anopheles gambiae


Alignment Length:164 Identity:47/164 - (28%)
Similarity:78/164 - (47%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 IVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA--PKNFDFSRCIFTGWGKNSFDDPSY 247
            |.|||.::..:..|:|||:.|...:|.:..:.||.:|:.  .:.|:......:|:|::|...|..
Mosquito   182 IRRHPEYDDTSLRNDVALILLNSPMTFTSRVKPISLPARTDTRQFEGFTGTVSGFGRSSDASPYP 246

  Fly   248 MNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSL-MCAGGEPGKDSCEGDGGSPLACAIKDNPQ 311
            .::|:..|.|::.:..|    .:.:|  |.|..|. :|.....|:.||.||.|.||..    |..
Mosquito   247 SSILRFTSNPIMSKAEC----IVSWG--FALAQSQNVCLKPTGGRSSCNGDSGGPLTV----NSG 301

  Fly   312 RYELAGIVNFGVDCG-LPGVPAVYTNVANVIEWI 344
            .....|.|:||...| ..|.|::|..|:..:.||
Mosquito   302 GVLQIGTVSFGSSYGCASGWPSMYARVSYFLSWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 45/162 (28%)
Tryp_SPc 113..344 CDD:238113 45/162 (28%)
AgaP_AGAP012736XP_307014.4 Tryp_SPc <7..167 CDD:238113
Tryp_SPc <7..166 CDD:214473
Tryp_SPc <168..335 CDD:214473 45/162 (28%)
Tryp_SPc <169..338 CDD:238113 47/164 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.