DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Cfi

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_031712.2 Gene:Cfi / 12630 MGIID:105937 Length:603 Species:Mus musculus


Alignment Length:347 Identity:82/347 - (23%)
Similarity:138/347 - (39%) Gaps:91/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQVQAQGQNAELNQSCGASNEHQ----CVPRHMCKVKIEFRMAMTYRNLGCVSTAICCPKNLIIK 78
            |:.:.:.:..|: .:.|..||.:    .:|:..|.||                      :|...:
Mouse   316 GEAEIETEETEM-LTPGMDNERKRIKSLLPKLSCGVK----------------------RNTHTR 357

  Fly    79 EPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSS----YVAG-GAL 138
            ..|:|..:|                         |...:.||.||:.|.:..:    |:.| ..|
Mouse   358 RKRVIGGKP-------------------------ANVGDYPWQVAIKDGQRITCGGIYIGGCWIL 397

  Fly   139 IAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVR---HPGFNLENGANNV 200
            .|.|.|..:|..:..:..:.|     :|       ..|:..:.|:::.|   |..:|.....|::
Mouse   398 TAAHCVRPSRAHSYQVWTALL-----DW-------LKPNSQLGIQTVKRVIVHEKYNGATFQNDI 450

  Fly   201 ALVFLRRSLTSSRHIN-----PICMPSAPKNFD-FSRCIFTGWGKNSFDDPSYMNVLKKISLPVV 259
            ||:.::.. |..:...     |.|:|.:|..|. ..|||.:|||:...:...|.....::.|   
Mouse   451 ALIEMKMH-TGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDL--- 511

  Fly   260 QRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYELAGIVNFGV 323
             ...|.|    :|.:.: .:..:.|||...|. |:|:||.|.||.|  :|......:.|||::|.
Mouse   512 -IGNCSQ----FYPDRY-YEKEMQCAGTRDGSIDACKGDSGGPLVC--EDINNVTYVWGIVSWGE 568

  Fly   324 DCGLPGVPAVYTNVANVIEWIT 345
            :||.|..|.|||.|||..:||:
Mouse   569 NCGKPEFPGVYTRVANYFDWIS 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 67/245 (27%)
Tryp_SPc 113..344 CDD:238113 67/245 (27%)
CfiNP_031712.2 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 232..261 CDD:238060
LDLa 264..298 CDD:294076
Tryp_SPc 360..589 CDD:214473 70/277 (25%)
Tryp_SPc 361..592 CDD:238113 71/279 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.