DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss29

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:256 Identity:74/256 - (28%)
Similarity:119/256 - (46%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYV-------AGGALIAPHVVITARQ--RTENMTASQLVVRAGEWDF 168
            |.:.:.||.|:|   |...|.       .||::|.|..|:||..  |..:...|...:|.|| .:
Mouse    37 APQGKWPWQVSL---RIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGE-AY 97

  Fly   169 STKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR-- 231
            ....::|.||.    .::.||.|......::|||:.|..|:.|..::.|:.:||  ::.:.::  
Mouse    98 LYGGKELLSVS----RVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPS--ESLEVTKKD 156

  Fly   232 -CIFTGWGKNSFD---DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDN--------SLMC 284
             |..||||..|..   .|.|.  |:::.:.::....||:.    |.|.....|        .::|
Mouse   157 VCWVTGWGAVSTHRSLPPPYR--LQQVQVKIIDNSLCEEM----YHNATRHRNRGQKLILKDMLC 215

  Fly   285 AGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWIT 345
            ||.: |:|||.||.|.||.|.:..:   :.|.|:|::|..|.|...|.||..|.:.:.|||
Mouse   216 AGNQ-GQDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALRDFPGVYARVQSFLPWIT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/253 (28%)
Tryp_SPc 113..344 CDD:238113 71/253 (28%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 74/256 (29%)
Tryp_SPc 31..271 CDD:214473 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.