DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CTRC

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:127 Identity:37/127 - (29%)
Similarity:60/127 - (47%) Gaps:12/127 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVAL--LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            ||.::|  |...|..:..||.|||.:.|:||.....|....::.|  |:.:...:.|: .|:.|.
Human    42 PWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNTRTYRVAV--GKNNLEVEDEE-GSLFVG 103

  Fly   182 IRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPS----APKNFDFSRCIFTGWGK 239
            :.:|..|..:|.....|::||:.|...:..|..|...|:|.    .||::.   |..||||:
Human   104 VDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKDSLLPKDYP---CYVTGWGR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 37/127 (29%)
Tryp_SPc 113..344 CDD:238113 37/127 (29%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 37/127 (29%)
Tryp_SPc 30..>173 CDD:238113 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.