DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:242 Identity:70/242 - (28%)
Similarity:110/242 - (45%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTS------SYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFST- 170
            |:..|.|....|...|..      |:..||:||:...::||.....  ....::||.||:|.:. 
Mosquito    78 AKHGEFPHQALLGYPREDGSPEPYSFSCGGSLISDRFILTAAHCFS--YGDPVIVRLGEYDLTVD 140

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFT 235
            .|.||   |..|..|:|||.:......:::|||.|..::..|:.|.|.|:.:.| ..:.||.:.|
Mosquito   141 STTQL---DFGIAEIIRHPKYRNSRSYHDLALVRLNETVLFSKVIRPACLWTNP-TLNVSRFVAT 201

  Fly   236 GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE--LDNSLMCAGG-EPGKDSCEGD 297
            |:||...........|.|:.|.:.....|.:..|  ....|.  :|...:|.|. ..|||:|:||
Mosquito   202 GFGKQEEGSTDLSTKLMKVQLDLFPSSDCGELFR--DNRKFRDGIDEGQLCVGSLIGGKDTCQGD 264

  Fly   298 GGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .|.||....:.....|.:.|:.:.|..||:....|:|:.||:.::||
Mosquito   265 SGGPLQTITEPRSCIYNIVGVTSTGAACGVGNSKAIYSKVAHYLDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/240 (28%)
Tryp_SPc 113..344 CDD:238113 68/240 (28%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 70/242 (29%)
Tryp_SPc 72..311 CDD:214473 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.