DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:215 Identity:64/215 - (29%)
Similarity:103/215 - (47%) Gaps:14/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANN 199
            ||.||:...::||....  .....::||.||:|...:|:.  ..|..|.||.|||.::.....::
Mosquito   103 GGTLISDQHILTAAHCF--AYGDPVIVRVGEYDTELETDD--EYDSDIASIRRHPNYSNLRSYDD 163

  Fly   200 VALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTC 264
            :|||.|:..:..|:||.|.|:....:. :.:|.|.||:|.|.....:...|:.|::|.......|
Mosquito   164 IALVKLKHPIVLSKHIRPACLWETEER-NSTRYIATGFGYNETYGTTLSTVMMKVNLDEFPVSDC 227

  Fly   265 EQQL----RLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD 324
            |:..    |...|    :.:..:|.|. ..|:|:|:||.|.||..........|.:.||.:.|..
Mosquito   228 ERNFKGDRRFKQG----VRDGQLCVGSIVEGRDTCQGDSGGPLQVVTNTKSCSYGVVGITSVGGV 288

  Fly   325 CGLPGVPAVYTNVANVIEWI 344
            ||:....|:||.|::.|:||
Mosquito   289 CGIGNAKAIYTKVSHYIDWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/213 (29%)
Tryp_SPc 113..344 CDD:238113 62/213 (29%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 64/215 (30%)
Tryp_SPc 69..308 CDD:214473 62/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.