DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Ctrl

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:311 Identity:91/311 - (29%)
Similarity:138/311 - (44%) Gaps:66/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MCKVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDT 110
            |..:.:...:.:...:.||...||         .|.|..|:.|       ||.:.          
Mouse     1 MLLLSLTLSLVLLGSSWGCGVPAI---------TPALSYNQRI-------VNGEN---------- 39

  Fly   111 GLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQL 175
              |.....||.|:|.| .|..:..||:||:|:.|:||...  .:|..:..|..||:|.|:..|  
Mouse    40 --AVPGSWPWQVSLQD-NTGFHFCGGSLISPNWVVTAAHC--QVTPGRHFVVLGEYDRSSNAE-- 97

  Fly   176 PSVDVPIRSIVR---HPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA----PKNFDFSRCI 233
               .|.:.||.|   ||.:|.....|::.|:.|......:..::|:|:.|.    |...   .|:
Mouse    98 ---PVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCLASTNEALPSGL---TCV 156

  Fly   234 FTGWGKNSFDDPSYMNV----LKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSC 294
            .||||:.|    ...||    |:::.||:|....|.|    |:|  ..:.::::||||. |..||
Mouse   157 TTGWGRIS----GVGNVTPARLQQVVLPLVTVNQCRQ----YWG--ARITDAMICAGGS-GASSC 210

  Fly   295 EGDGGSPLACAIKDNPQRYELAGIVNFGV-DCGLPGVPAVYTNVANVIEWI 344
            :||.|.||.|. |.|  .:.|.|||::|. :|.:. .||:||.|:....||
Mouse   211 QGDSGGPLVCQ-KGN--TWVLIGIVSWGTKNCNIQ-APAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 78/242 (32%)
Tryp_SPc 113..344 CDD:238113 78/242 (32%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 81/268 (30%)
Tryp_SPc 34..260 CDD:238113 83/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.