DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and PRSS21

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:289 Identity:88/289 - (30%)
Similarity:140/289 - (48%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IKEPRLIINEPITDPQCG--FVNSKGVTFSFREEDTGLAQEAEV---PWMVALLDARTSSYVAGG 136
            :::|......|::.| ||  .:.|:.|.          .::||:   ||..:|  ....|:|.|.
Human    18 LRKPESQEAAPLSGP-CGRRVITSRIVG----------GEDAELGRWPWQGSL--RLWDSHVCGV 69

  Fly   137 ALIAPHVVITARQRTENMTASQLVVRAGEW--DFSTKTEQLPS--------VDVPIRSIVRHPGF 191
            :|::....:||....|  |.|.|...:| |  .|...| .:||        ....:.:|...|.:
Human    70 SLLSHRWALTAAHCFE--TYSDLSDPSG-WMVQFGQLT-SMPSFWSLQAYYTRYFVSNIYLSPRY 130

  Fly   192 NLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR---CIFTGWGKNSFDD--PSYMNVL 251
             |.|...::|||.|...:|.::||.|||:.::  .|:|..   |..||||....|:  || .:.|
Human   131 -LGNSPYDIALVKLSAPVTYTKHIQPICLQAS--TFEFENRTDCWVTGWGYIKEDEALPS-PHTL 191

  Fly   252 KKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYEL 315
            :::.:.::....| ..|.|.|....::...::||| .:.|||:|.||.|.||||  ..|...|::
Human   192 QEVQVAIINNSMC-NHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLAC--NKNGLWYQI 253

  Fly   316 AGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
             |:|::||.||.|..|.||||:::..|||
Human   254 -GVVSWGVGCGRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 79/249 (32%)
Tryp_SPc 113..344 CDD:238113 79/249 (32%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 82/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.