DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and Prss48

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:243 Identity:75/243 - (30%)
Similarity:123/243 - (50%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEW------DFSTKTEQLP 176
            ||.|:| .|   |:::.||:||:.|.|:||....:....|.|.   ..|      |:|:..|:..
  Rat    52 PWQVSLRFD---STHICGGSLISNHWVMTAAHCIKKTWFSFLY---SVWLGSIDRDYSSTGEEYY 110

  Fly   177 SVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKN 240
            ...:.|.|  :|     .|...::||:.|...:|.:..:.|||:|:..|.... :.|..||||:|
  Rat   111 VSRIVIPS--KH-----HNTDGDIALLKLSSRVTFTSLVLPICLPNISKPLTVPASCWVTGWGQN 168

  Fly   241 SFDDPSYMNVLKKISLPVVQRRTCEQQLRLY-----YGNDFE--LDNSLMCAGG-EPGKDSCEGD 297
              .:..|.:.|:::.:|::....|||   ||     :..|.|  :...::|||. :..||||:||
  Rat   169 --QEGHYPSTLQELEVPIITGEACEQ---LYNPIGFFLPDLERIIKEDMLCAGEIQQSKDSCKGD 228

  Fly   298 GGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWIT 345
            .|.||:|.|..   .:...|::::|::|| ..:|.|||||....:||:
  Rat   229 SGGPLSCHIDG---VWTQIGVISWGLECG-KNLPGVYTNVTYYQKWIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 73/240 (30%)
Tryp_SPc 113..344 CDD:238113 73/240 (30%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.