DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and MASP2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:281 Identity:76/281 - (27%)
Similarity:116/281 - (41%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRT 151
            |:.:|.||.   ...|...|......|:..:.||.|.:|...|    |.|||:..:.|:||....
Human   428 PVCEPVCGL---SARTTGGRIYGGQKAKPGDFPWQVLILGGTT----AAGALLYDNWVLTAAHAV 485

  Fly   152 --ENMTASQLVVRAG-----------EWDFSTKTEQLPSVDVPIRSIVRHPGFNLENG-ANNVAL 202
              :...||.|.:|.|           .|.               .::..|.|:..:.| .|::||
Human   486 YEQKHDASALDIRMGTLKRLSPHYTQAWS---------------EAVFIHEGYTHDAGFDNDIAL 535

  Fly   203 VFLRRSLTSSRHINPICMP-----SAPKNFDFSRCIFTGWG--KNSFDDPSYMNVLKKISLPVVQ 260
            :.|...:..:.:|.|||:|     |..:..|....  :|||  :..|    ....|..:.:|:|.
Human   536 IKLNNKVVINSNITPICLPRKEAESFMRTDDIGTA--SGWGLTQRGF----LARNLMYVDIPIVD 594

  Fly   261 RRTCEQQLRLYYGNDFELDNSLMCAGGEP-GKDSCEGDGGSPLACAIKDNPQRYELAGIVNFG-V 323
            .:.|.............:..:::|||.|. |||||.||.|..|. .:....:|:.:.|||::| :
Human   595 HQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALV-FLDSETERWFVGGIVSWGSM 658

  Fly   324 DCGLPGVPAVYTNVANVIEWI 344
            :||..|...|||.|.|.|.||
Human   659 NCGEAGQYGVYTKVINYIPWI 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/253 (27%)
Tryp_SPc 113..344 CDD:238113 68/253 (27%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512 1/1 (100%)
Tryp_SPc 444..679 CDD:214473 69/260 (27%)
Tryp_SPc 445..682 CDD:238113 70/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.