DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and CG42694

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:406 Identity:87/406 - (21%)
Similarity:148/406 - (36%) Gaps:101/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 INEPITDPQCGF-VNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITA 147
            :|....|..||. ::::.:| ..|:...|        |:..:  :..:..:..|:||:...|::|
  Fly    18 VNSKFLDDYCGAPISNQSIT-KLRQPQAG--------WLAHI--SNGTHVLCSGSLISKQFVLSA 71

  Fly   148 RQRTENMTASQLVVRAG--------EWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVF 204
            .|..:  ...:|.|:.|        .| ::.....:||          |.|..|:   .::.|:.
  Fly    72 AQCID--VHGKLFVQLGVSNATKSPHW-YTVSNVVIPS----------HSGKRLQ---RDIGLLK 120

  Fly   205 LRRSLTSSRHINPICMPSAPKNFDFSRCI--FT--GW-GKNSFDDPSYMNVLKKISLPVVQRRTC 264
            |.:|:..:..:.|||:.......|..:.:  ||  .| .||.  :|..: ||.::|     |..|
  Fly   121 LSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNK--NPQTI-VLSQLS-----RDRC 177

  Fly   265 EQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAI--KDNPQRYELAGI---VNFGVD 324
            :..|.   ||   :....:||......:||..|.||.|...|  ..|..|..|.||   ||....
  Fly   178 KLNLS---GN---VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSW 236

  Fly   325 CGLPGVPAVYTNVANVIEWITLTTVN---------MPLPEEREEVPYASPTLSAGPYLNQWNQPN 380
            |   ..||:|.:||..:.||. |.|.         :..||..:.:.::...:.....|       
  Fly   237 C---SEPAIYIDVAECVGWIE-TVVQQYDGTDSRAVATPEVNQHLKHSLSRMGKNILL------- 290

  Fly   381 YEWLPTGYPNVNSIPWQLQEANNDLANSQYVRYYPVENVGINIHSAGHGNDQQIVRPIQQDIPKD 445
                   :.|..         .|.|.:....|.|     |.|....|.....:.|....:|:|:.
  Fly   291 -------FKNCR---------GNSLQSKLRARIY-----GPNYIGQGWFITHRFVITNAKDLPES 334

  Fly   446 SDDLFNSVFSTTMEYN 461
            ::.|:..:..|...|:
  Fly   335 AESLYVGLPGTLRSYD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 59/248 (24%)
Tryp_SPc 113..344 CDD:238113 59/248 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 61/245 (25%)
Tryp_SPc 46..253 CDD:214473 59/241 (24%)
Tryp_SPc 319..505 CDD:304450 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.