DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and LOC101734670

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_004920158.2 Gene:LOC101734670 / 101734670 -ID:- Length:275 Species:Xenopus tropicalis


Alignment Length:274 Identity:78/274 - (28%)
Similarity:124/274 - (45%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL--LDARTSSYVAGGALIAPHVVITARQ 149
            |...|....||.:.            |:....||.|:|  |:.....:..||.|||...::||..
 Frog    20 PTYAPSARVVNGEN------------AKPYSWPWQVSLQFLEDGVFLHNCGGTLIADRWILTAAH 72

  Fly   150 RTENMTASQLVVRAGEWDFSTK--TEQ---LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSL 209
            .......:::||  |::|.:.:  .||   :||.|:.:....:   :|.....|::||:.|.|.:
 Frog    73 CINFSWTNRVVV--GDYDLANEEGAEQIFLIPSEDMFVHQSWK---YNCIPCGNDIALIRLSRPV 132

  Fly   210 TSSRHINPICMPSA----PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRL 270
            ..|..:...|:|.|    |.||.   |..:|||:.....| ..::|::..||||....|.|  |.
 Frog   133 QISDKVQLSCLPPAGELLPNNFS---CYASGWGRLYTGGP-IPDILQQALLPVVDHNHCTQ--RD 191

  Fly   271 YYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF--GVDCGLPGVPAV 333
            ::|.  ::..|::||||:. :..|.||.|.||.|...|.  |:.:.|:.:|  |..|.....|:|
 Frog   192 WWGT--KVKRSMVCAGGDI-RSVCNGDSGGPLNCQGADG--RWYVHGVASFVHGYGCNTLKKPSV 251

  Fly   334 YTNVANVIEWITLT 347
            :|.|:....||..|
 Frog   252 FTRVSAFNSWIQQT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/243 (29%)
Tryp_SPc 113..344 CDD:238113 71/243 (29%)
LOC101734670XP_004920158.2 Tryp_SPc 28..265 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.