DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and gprin3

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_017951795.1 Gene:gprin3 / 101733019 XenbaseID:XB-GENE-6468967 Length:725 Species:Xenopus tropicalis


Alignment Length:444 Identity:95/444 - (21%)
Similarity:146/444 - (32%) Gaps:141/444 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IKEPRLIINEPITDPQCGF-VNS--KGVTFSFREEDTGL-----AQEAEVPWMVALLDARTSSYV 133
            :|:..|:  .|:...:.|. |:|  |.......|.|.||     .:||: |.:.:|...:|.|..
 Frog   137 VKDNTLV--APLVSAEAGMQVSSDFKNKPLVESEPDKGLDSLLQNKEAD-PSLPSLPTHKTESIN 198

  Fly   134 AG----GALIAPHVVITARQRT--ENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPG-- 190
            :|    ..:|....||||...:  :::|:::....:.|.|...|..:....|.|:.|..:..|  
 Frog   199 SGTQNASTIIESEGVITAEGESTKDSITSNECHKLSFEKDKIKKENEEVETDPPLPSRFKEMGTM 263

  Fly   191 --FNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKK 253
              |:|||.....|.|                  .|..|.:         .|:....||.:....|
 Frog   264 TSFSLENWTTQDAEV------------------QAVANVE---------NKSVSTSPSILAAFLK 301

  Fly   254 ISLPVVQRRTCEQQLRLYYGN---------DFELDNSL--------MCAGGEPGKDSCEGDGGSP 301
            .:.|.::.|. ||...:|.||         :|.|...|        :|........|      .|
 Frog   302 ANSPALKERQ-EQVCIIYQGNPGASQLDRANFALQAQLSQNQLAPKLCFQAPDALSS------QP 359

  Fly   302 LACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVA--------NVIEWITLTTVNMPLPEERE 358
            |....|..|             |...|...  :|.:.        |.||...|....||      
 Frog   360 LQMHTKSPP-------------DLARPTFQ--HTEIGRNSQILYRNEIEGQGLCFREMP------ 403

  Fly   359 EVPYASPT---------------LSAGP---YLNQWNQPNYEWLPTGYPNVNSIPWQLQEANNDL 405
            ::..|||:               .||.|   .::.:::|::              ::..|.||  
 Frog   404 QMQMASPSPILMNVKPVYQINIENSAQPKPRTMDMYSEPSH--------------FRAPEINN-- 452

  Fly   406 ANSQYVRYYPVENVGINIHSAGHGNDQQIVRPIQQDIPKDSDDLFNSVFSTTME 459
             .|:......|||  |.:|:....|||.....|..|   ||.|.....|..|.|
 Frog   453 -KSRLHHLSGVEN--IQLHNIRLDNDQTDTLSIPGD---DSTDRKPFHFKITNE 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 54/265 (20%)
Tryp_SPc 113..344 CDD:238113 54/265 (20%)
gprin3XP_017951795.1 GRIN_C 600..720 CDD:373668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.