DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:296 Identity:87/296 - (29%)
Similarity:129/296 - (43%) Gaps:43/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGF---VNSK--GVTFSFREEDTGLAQEAEV 118
            |.||.  .:|.|...|::  ..|.|        .||.   |:|:  |.|         .|...:.
 Frog   233 YTNLN--YSATCASGNMV--SLRCI--------SCGLSTKVDSRIVGGT---------PASVGDW 276

  Fly   119 PWMVALLD-ARTSSYVAGGALIAPHVVITARQRT--ENMTASQLVVRAGEWDFSTKTEQLPSVDV 180
            ||.|.||. ..||.|:.||::|.||.::||....  ...|.|...|.||    |...:...|...
 Frog   277 PWQVELLKLVGTSIYLCGGSIITPHWIVTAAHCVYGSTSTPSAFKVFAG----SLTIQSYYSAGY 337

  Fly   181 PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGKNSFDD 244
            .:...:.||.::......:|||:.|..:|..:.::.|:|:|:....: :...|..:|||..: :.
 Frog   338 TVERALVHPSYSSYTQIYDVALLKLTAALVFTTNLRPVCLPNVGMPWAEGQPCWISGWGTTA-EG 401

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKD 308
            .|....|...|:|::...||.|  ...||.  .:.:::||||. ..|.|:|:||.|.||  ..|.
 Frog   402 GSISKNLMAASVPIISSTTCNQ--AAVYGG--AISSTMMCAGYLSGGTDTCQGDSGGPL--VTKT 460

  Fly   309 NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            | ..:.|.|..::|..|.....|.||.||...||||
 Frog   461 N-SLWWLVGDTSWGYGCARAYKPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/235 (30%)
Tryp_SPc 113..344 CDD:238113 71/235 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 10/37 (27%)
Tryp_SPc 265..498 CDD:238113 75/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.