DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and cela1.2

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:282 Identity:74/282 - (26%)
Similarity:113/282 - (40%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL--LDARTSSYVAGGA 137
            |.:.|||.:               |.:....|.....:|:....||.::|  .|..|..|...|.
Zfish    13 LALAEPRYL---------------KDIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGT 62

  Fly   138 LIAPHVVITARQRTENMTASQLVVRAGEW-----DFSTKTEQLPSVDVPIRSIVRHPGFNLENGA 197
            ||.|..|         |.|:..|....:|     |....|.:.|...:.:..:..||.:|..|.|
Zfish    63 LIRPGWV---------MVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNPNNVA 118

  Fly   198 NNVALVFLRRSL--TSSRHINPICMPSAPKNFDFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVV 259
            ....:..||.|:  |.|.::....:||:.:...:.. |..||||... ...|....||:..:|||
Zfish   119 FGYDIALLRLSIDATLSSYVQVATLPSSGEILPYGHTCYITGWGYTE-TGGSLSAQLKQAYMPVV 182

  Fly   260 QRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNF--G 322
            ...||.|  :.::|:  .:..:::||||.....:|.||.||||.|....   :|.:.|:.:|  .
Zfish   183 DYETCSQ--KDWWGS--SVKETMICAGGTTSMSACHGDSGSPLNCLFNG---KYVVHGVTSFVSP 240

  Fly   323 VDCGLPGVPAVYTNVANVIEWI 344
            ..|.....|..:|.|:..|.||
Zfish   241 EGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/242 (27%)
Tryp_SPc 113..344 CDD:238113 66/242 (27%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 67/249 (27%)
Tryp_SPc 30..265 CDD:238113 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.