DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:272 Identity:80/272 - (29%)
Similarity:131/272 - (48%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SKGVTFSFREEDTGLAQEAEV-------------PWMVALLDARTSSYVAGGALIAPHVVITARQ 149
            |.|:..|.:..|.||:...|.             ||.|.|....|:  :.||::||.:.::||..
 Frog   239 SSGLVVSLKCIDCGLSTYGESRIVGGSSASIGDWPWQVNLQYDDTN--LCGGSVIAANWIVTAAH 301

  Fly   150 RTENMTASQLVVRAGEWDFSTKTEQLP--------SVDVPIRSIVRHPGFNLENGANNVALVFLR 206
            ..:..|:|..:.:|    |..|. ::|        |||    .|:.||.::.:..:|::||:.|:
 Frog   302 CVQGDTSSPSLWKA----FIGKI-KMPSYYDSSAYSVD----RIIVHPDYSSQTNSNDIALMKLK 357

  Fly   207 RSLTSSRHINPICMPSAPKNFDFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRL 270
            .|:..|....|:|:|:....::..: |..:|||..| ...|..:|||...:|::...||.|.: :
 Frog   358 TSIAFSSISRPVCLPNYGMQWEEGQPCYISGWGTTS-QKGSISSVLKYAMVPLISPTTCNQTI-M 420

  Fly   271 YYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVY 334
            |.|   .:.:|::||| .:.|.|||:||.|.||  ..|.| ..:.|.|..::|..|.....|.||
 Frog   421 YNG---AITSSMICAGYPKGGVDSCQGDSGGPL--VTKTN-SLWWLVGDTSWGDGCANVYRPGVY 479

  Fly   335 TNVANVIEWITL 346
            .|:...::||.|
 Frog   480 GNMTVFLQWIYL 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 71/253 (28%)
Tryp_SPc 113..344 CDD:238113 71/253 (28%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 6/15 (40%)
Tryp_SPc 261..489 CDD:238113 70/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.