DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss3

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:270 Identity:73/270 - (27%)
Similarity:131/270 - (48%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTAS 157
            ||...|  .|.|.|.....::...:.||..:|:  ....::.||:||.|..::||.....::...
 Frog   232 CGLRPS--YTSSARIVGGNVSAVGQWPWQASLV--FQGVHLCGGSLITPQWIVTAAHCVYDLLYP 292

  Fly   158 Q-LVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP 221
            : ..|:.|:...::::.|   ..||::.|:.|..:.....||::||:.|....|.:..|.|||:|
 Frog   293 EWWRVQVGQVSQASESAQ---TAVPVQKIIYHSKYRSSTMANDIALIRLASPFTFNGSIQPICLP 354

  Fly   222 SAPKNFDFSR-CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCA 285
            :..::|...: |..:|||... :.......:....:|::..|.|  ..:..||.  .:..|::||
 Frog   355 NYREDFPEGKICWISGWGATE-EGGDTSQTMDYAGVPLISNRVC--NTKYIYGG--VIKPSMVCA 414

  Fly   286 GG-EPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTV 349
            |. |.|.|:|:||.|.||||   ::...::|.|..::|:.|.|...|.|||.:::.::||.:.. 
 Frog   415 GFLEGGVDTCQGDSGGPLAC---EDSNVWKLMGTTSWGIGCALRYKPGVYTRISSFLDWIHIQM- 475

  Fly   350 NMPLPEEREE 359
                  |:||
 Frog   476 ------EKEE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/233 (27%)
Tryp_SPc 113..344 CDD:238113 62/233 (27%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055 2/3 (67%)
Tryp_SPc 244..472 CDD:238113 63/240 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.