DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss9

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:275 Identity:79/275 - (28%)
Similarity:132/275 - (48%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPS 177
            |...|:||..:|.:.  |.:..|..:|....:::|..........|:....|....|  .....:
 Frog   553 AVRGEIPWQASLKEG--SRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAHMGSTALS--GADTIA 613

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS-RCIFTGWGKNS 241
            :.:.::.:::||.||......:||::.|..|||.::::.|:|:|||.:.|... :|:.:|||...
 Frog   614 IKISLKRVIQHPHFNPLTLDFDVAVLELASSLTFNKYVQPVCLPSALQKFPAGWKCMISGWGNIK 678

  Fly   242 FDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACA 305
            ..:.|...||:|.|:.::.::.|..   ||   :|.:...::|||...|| |||:||.|.|||| 
 Frog   679 EGNVSKPEVLQKASVGIIDQKICSV---LY---NFSITERMICAGFLDGKVDSCQGDSGGPLAC- 736

  Fly   306 IKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTV---------------NMPLPE 355
             :::|..:.|||||::|:.|.....|.||:.|..:.:|| |.||               :.|||.
 Frog   737 -EESPGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWI-LDTVAPVLRTTDSGMNLPRSSPLPI 799

  Fly   356 EREEVPYASPTLSAG 370
            .........|..|.|
 Frog   800 STTRPSTFQPATSNG 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/232 (29%)
Tryp_SPc 113..344 CDD:238113 68/232 (29%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113 68/232 (29%)
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.