DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss6

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:347 Identity:100/347 - (28%)
Similarity:162/347 - (46%) Gaps:65/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGQNAEL-NQ-------SCGASN----EHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICCPKN 74
            |.|.:.|| ||       :|||.|    :..||.:               .|..|.|.|.|    
 Frog   506 ANGTDEELCNQGANFPTAACGAFNYKCADGSCVQK---------------PNAECDSIADC---- 551

  Fly    75 LIIKEPRLIINEPITDPQCGF-VNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGAL 138
                      .:...:..||. :.:.|:    |......|||.|.||. |.|..| ..::.||.|
 Frog   552 ----------PDGSDENNCGCGIQAVGI----RLVGGTQAQEGEWPWQ-ASLQVR-GEHICGGTL 600

  Fly   139 IAPHVVITARQ--RTENMTASQL-VVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNV 200
            :|...::||..  ..|:..:.:: .|..|:...|..|::..:..| ||.:: ||.::.::...:|
 Frog   601 VADQWILTAAHCFTPESYASPEVWTVYLGKVRLSRSTQKELAFKV-IRLVI-HPFYDEDSHDYDV 663

  Fly   201 ALVFLRRSL-TSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRT 263
            |||.|...: .:|.|:.|||:||:..:|.. |.|..||||....:.|: .:||:|:.:.:|.:..
 Frog   664 ALVLLDHLVPLTSPHVQPICLPSSTHHFPTGSSCWVTGWGSVKENGPT-SDVLQKVDIQLVAQDI 727

  Fly   264 CEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGL 327
            |.:..|      :::...::|||...| ||:|:||.||||.|  |....|:..||:|::|..||:
 Frog   728 CTELYR------YQISPRMLCAGYRDGSKDACQGDSGSPLVC--KTASGRWFQAGLVSWGAGCGI 784

  Fly   328 PGVPAVYTNVANVIEWITLTTV 349
            |....||:.:..:::||...|:
 Frog   785 PRYFGVYSRITRLVQWIESITL 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 76/236 (32%)
Tryp_SPc 113..344 CDD:238113 76/236 (32%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060 3/7 (43%)
LDLa 525..560 CDD:238060 11/63 (17%)
Tryp_SPc 572..804 CDD:238113 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.