DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and klkb1

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_002934450.3 Gene:klkb1 / 100486524 XenbaseID:XB-GENE-985051 Length:629 Species:Xenopus tropicalis


Alignment Length:350 Identity:86/350 - (24%)
Similarity:139/350 - (39%) Gaps:78/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SNEHQCVPRHMCKVKIEFRMAMTYRNL--GCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNS 98
            |.|.:|.......::.:|   .|||.:  ||......|...                     ::|
 Frog   311 SGEKECQQECTNNIRCQF---FTYRPMQSGCSENKCKCHMK---------------------ISS 351

  Fly    99 KGVTFSFRE---EDTGLAQE----------------------------AEVPWMVALLDARTSSY 132
            .|:....|.   |.:|.:..                            .|.||.|::....|:||
 Frog   352 NGLPTGIRHGNGEISGFSLRLCKIKSVKGCGEPIEHANRIVGGTDSVLGEWPWQVSMHLRLTASY 416

  Fly   133 ---VAGGALIAPHVVITARQRTENMTASQL-VVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNL 193
               ..||::|:...::||..........|: ::.:|....|..|:..|..:.  ..|:.||.:..
 Frog   417 KKHACGGSIISNQWIVTAAHCFAMHPLPQMWIIYSGVVKLSNITQSTPFSET--EQIIIHPHYTG 479

  Fly   194 ENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSFDDPSYMNVLKKISLP 257
            .....::||:.|:..::.:.|...||:|.....|.. :.|..||||... :..|..|:|:|..:|
 Frog   480 AGNGTDIALLKLKTPISFNDHQKAICLPPREPTFVLPNSCWITGWGFTE-ESGSLANILQKAEVP 543

  Fly   258 VVQRRTCEQQLRLYYGN--DFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYELAGIV 319
            .:....|:       ||  ...:|..::|||.:.|| |||:||.|.||||.:   .:.:.|.||.
 Frog   544 QISTEECQ-------GNYEQTRIDKKILCAGYKRGKIDSCKGDSGGPLACVV---DEIWYLTGIT 598

  Fly   320 NFGVDCGLPGVPAVYTNVANVIEWI 344
            ::|..|..||.|.|||.|:...:||
 Frog   599 SWGEGCARPGKPGVYTRVSEFTDWI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 69/266 (26%)
Tryp_SPc 113..344 CDD:238113 69/266 (26%)
klkb1XP_002934450.3 APPLE 21..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 290..373 CDD:128519 15/85 (18%)
Tryp_SPc 391..626 CDD:238113 70/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.