DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and hgfac

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_002939269.3 Gene:hgfac / 100485696 XenbaseID:XB-GENE-940012 Length:595 Species:Xenopus tropicalis


Alignment Length:377 Identity:100/377 - (26%)
Similarity:150/377 - (39%) Gaps:61/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQVQAQGQNAELNQSC----------GASNE----HQCVP--RHMCKVKIEFRMAMTY--RNLG- 63
            ||...:..|.::.|||          |...|    |.|:|  ..|...:|.....|.:  :.|| 
 Frog   220 GQYVGKYCNIDVTQSCYDSDNATEYRGIKKETQSGHSCLPWNSDMLYEEIHTGQGMNFIPKGLGS 284

  Fly    64 --------------C-------VSTAICCPKNLIIKEPRLIINEPI---TDPQCGFVNSKGVTFS 104
                          |       ||...|.......|..|:|:.|..   ..|:||..:.|.|...
 Frog   285 HPYCRSPDDDEIPWCYLMNDRLVSWEHCSIPKCRDKGRRVIMQEDAVVPAPPKCGKKHEKRVVAR 349

  Fly   105 FREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAP-HVVITARQRTENMTASQLVVRAGEWDF 168
            .|......|.....||:..:.   ..:|...|:||.| .||..|....::.:.|::.|..|:..|
 Frog   350 GRILGGNSALPGSHPWVAGIY---IGNYFCAGSLIQPCWVVSAAHCFADSPSKSKIRVVLGQHFF 411

  Fly   169 STKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRR----SLTSSRHINPICMPSAPKNF-D 228
            :..|:...:.:|. |.|........:...:::.|:.|:|    ....::.:..||:|.....| |
 Frog   412 NQTTDVTQTFEVE-RYIFYDKYSVFKRNEHDIVLIKLKRINNACAKKTQFVQTICLPDVSAPFAD 475

  Fly   229 FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKD 292
            ...|...|||:...|...|...|::..:|:|....|...  ..||  .|:..::.||| .:...|
 Frog   476 DHHCQIAGWGRMHEDSTEYAQNLQEAIVPLVPDNKCSSP--EIYG--AEISENMFCAGYFDCTID 536

  Fly   293 SCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ||:||.|.||||. ||...  .|.|||::|..||....|.|||.|:|.::||
 Frog   537 SCQGDSGGPLACE-KDKIS--YLWGIVSWGEGCGNHNKPGVYTKVSNYVDWI 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/237 (29%)
Tryp_SPc 113..344 CDD:238113 68/237 (29%)
hgfacXP_002939269.3 FN2 52..98 CDD:238019
EGF_CA 109..145 CDD:238011
FN1 147..185 CDD:238018
KR 235..319 CDD:294073 15/83 (18%)
Tryp_SPc 351..585 CDD:214473 69/244 (28%)
Tryp_SPc 352..588 CDD:238113 70/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.