DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and zgc:163079

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:314 Identity:88/314 - (28%)
Similarity:135/314 - (42%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWM 121
            |.:.::.||:.||.......:.:..:....|:.....|.:|               |.:...||.
Zfish     1 MKFNSVFCVAGAILLNIAGCLGQSDVCGRAPLNTKIIGGLN---------------ATQGSWPWQ 50

  Fly   122 VALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLP-SVDVPIRSI 185
            .::....|..:..||:||....|:|..:....|.||.:||..|.   .|:....| .:...:..|
Zfish    51 ASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGR---QTQNGSNPYEISRTVTKI 112

  Fly   186 VRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGKNSFDDPSYMN 249
            ::||.:|..:  :|:||:.|...:|.|.:|.|:|:.:|...| |.:....||||        |:|
Zfish   113 IKHPNYNSLD--SNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGTASWVTGWG--------YLN 167

  Fly   250 ------------VLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGS 300
                        ||:::..|:|....|...    ||.  .:.|.|:|||  .|.||..|.||.|.
Zfish   168 RPATVEEIMLPDVLQEVEAPIVNNFECNAA----YGG--IITNKLLCAGYLNEDGKAPCAGDVGG 226

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLP 354
            ||  .||......: :|:|..|. |||||.|.:|..|:...:||:..| |..||
Zfish   227 PL--VIKQGAIWIQ-SGVVVSGY-CGLPGYPTIYVRVSEYEDWISYYT-NSSLP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 74/246 (30%)
Tryp_SPc 113..344 CDD:238113 74/246 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 76/268 (28%)
Tryp_SPc 36..267 CDD:238113 77/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.