DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31780 and tmprss3a

DIOPT Version :9

Sequence 1:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:264 Identity:73/264 - (27%)
Similarity:122/264 - (46%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWD 167
            ||.|.....|:.|.:.||.|:|  ...:.::.||::|....::||......:.....      |.
Zfish   294 FSARIVGGNLSAEGQFPWQVSL--HFQNEHLCGGSIITSRWILTAAHCVYGIAYPMY------WM 350

  Fly   168 FSTKTEQLPSVDV---PIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-D 228
            ......:||...|   .:..|:.|..:..:...:::||:.|.:.||.:..:.|||:|:..:.| |
Zfish   351 VYAGLTELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLPNFGEQFED 415

  Fly   229 FSRCIFTGWGKNSFDDPSYMNVLKK-ISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGK 291
            ...|..:|||  :.:|....:|.:. .|:|::..:.|.|. .:|.|   .|...::|||. :.|.
Zfish   416 GKMCWISGWG--ATEDGGDASVSQHCASVPLISNKACSQP-EVYQG---YLTAGMICAGYLDGGT 474

  Fly   292 DSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEE 356
            |||:||.|.||||   ::...::|.|..::|..|.....|.|||.:...:.||.|..       |
Zfish   475 DSCQGDSGGPLAC---EDSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIHLQM-------E 529

  Fly   357 REEV 360
            |||:
Zfish   530 REEI 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 62/236 (26%)
Tryp_SPc 113..344 CDD:238113 62/236 (26%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845
Tryp_SPc 298..525 CDD:238113 64/243 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.