DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and WFDC8

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:68 Identity:23/68 - (33%)
Similarity:33/68 - (48%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECIN 74
            |.|.....:....|.|.|| ..:|||.....||.:|.:...|..|.|.||:||.|:|.:::.|..
Human    80 FFACQKKCMDPFQEPCMLP-VRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRT 143

  Fly    75 KCV 77
            .|:
Human   144 ACM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 19/50 (38%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672 2/9 (22%)
KU 93..145 CDD:197529 20/52 (38%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.