DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and PAPLN

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_047287828.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1305 Species:Homo sapiens


Alignment Length:52 Identity:23/52 - (44%)
Similarity:33/52 - (63%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.|| :|:|:|....:||.:.|....|..|.||||.||.|:|.|::||::.|
Human   781 CLLP-SAHGSCADWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSC 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 22/50 (44%)
PAPLNXP_047287828.1 ADAMTS_CR_3 112..209 CDD:437068
ADAMTS_spacer1 211..325 CDD:461796
TSP1_ADAMTS 335..387 CDD:465950
TSP1_ADAMTS 393..451 CDD:465950
TSP1_ADAMTS 454..507 CDD:465950
TSP1_ADAMTS 515..565 CDD:465950
Kunitz_papilin 781..831 CDD:438678 22/50 (44%)
Papilin_u7 841..932 CDD:374683
Ig 941..>1005 CDD:472250
Ig strand B 954..958 CDD:409353
Ig strand C 967..971 CDD:409353
Ig strand E 988..992 CDD:409353
I-set 1076..1146 CDD:400151
Ig strand B 1088..1092 CDD:409353
Ig strand C 1101..1105 CDD:409353
Ig strand E 1122..1126 CDD:409353
Ig strand F 1136..1141 CDD:409353
IG_like 1166..1246 CDD:214653
Ig strand B 1177..1181 CDD:409353
Ig strand C 1189..1193 CDD:409353
Ig strand E 1212..1216 CDD:409353
Ig strand F 1226..1231 CDD:409353
Ig strand G 1239..1242 CDD:409353
PLAC 1262..1294 CDD:462560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.