| Sequence 1: | NP_001036330.1 | Gene: | Acp24A4 / 318936 | FlyBaseID: | FBgn0051779 | Length: | 78 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_047287828.1 | Gene: | PAPLN / 89932 | HGNCID: | 19262 | Length: | 1305 | Species: | Homo sapiens |
| Alignment Length: | 52 | Identity: | 23/52 - (44%) |
|---|---|---|---|
| Similarity: | 33/52 - (63%) | Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Acp24A4 | NP_001036330.1 | Kunitz-type | 25..76 | CDD:438633 | 22/50 (44%) |
| PAPLN | XP_047287828.1 | ADAMTS_CR_3 | 112..209 | CDD:437068 | |
| ADAMTS_spacer1 | 211..325 | CDD:461796 | |||
| TSP1_ADAMTS | 335..387 | CDD:465950 | |||
| TSP1_ADAMTS | 393..451 | CDD:465950 | |||
| TSP1_ADAMTS | 454..507 | CDD:465950 | |||
| TSP1_ADAMTS | 515..565 | CDD:465950 | |||
| Kunitz_papilin | 781..831 | CDD:438678 | 22/50 (44%) | ||
| Papilin_u7 | 841..932 | CDD:374683 | |||
| Ig | 941..>1005 | CDD:472250 | |||
| Ig strand B | 954..958 | CDD:409353 | |||
| Ig strand C | 967..971 | CDD:409353 | |||
| Ig strand E | 988..992 | CDD:409353 | |||
| I-set | 1076..1146 | CDD:400151 | |||
| Ig strand B | 1088..1092 | CDD:409353 | |||
| Ig strand C | 1101..1105 | CDD:409353 | |||
| Ig strand E | 1122..1126 | CDD:409353 | |||
| Ig strand F | 1136..1141 | CDD:409353 | |||
| IG_like | 1166..1246 | CDD:214653 | |||
| Ig strand B | 1177..1181 | CDD:409353 | |||
| Ig strand C | 1189..1193 | CDD:409353 | |||
| Ig strand E | 1212..1216 | CDD:409353 | |||
| Ig strand F | 1226..1231 | CDD:409353 | |||
| Ig strand G | 1239..1242 | CDD:409353 | |||
| PLAC | 1262..1294 | CDD:462560 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||