DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG42464

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001162863.1 Gene:CG42464 / 8674117 FlyBaseID:FBgn0259954 Length:87 Species:Drosophila melanogaster


Alignment Length:75 Identity:32/75 - (42%)
Similarity:43/75 - (57%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVFIALASNSLALKNEICGLPAAANG-----NCLALFSRW-SYDAQYNVCFNFIYGGCQGNENSF 66
            ::|||||..:....:|||.|...|||     :| |.:|.| ||.:..|.|..|.||||.||||.|
  Fly     7 YLFIALAGVNAESADEICQLTPEANGFGKIMSC-AHYSNWFSYHSDKNECLEFSYGGCGGNENRF 70

  Fly    67 ESQEECINKC 76
            :::..|.:.|
  Fly    71 QTKAICEDLC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 26/59 (44%)
CG42464NP_001162863.1 KU 22..80 CDD:197529 26/58 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
54.860

Return to query results.
Submit another query.