DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and CG42464

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001162863.1 Gene:CG42464 / 8674117 FlyBaseID:FBgn0259954 Length:87 Species:Drosophila melanogaster


Alignment Length:75 Identity:32/75 - (42%)
Similarity:43/75 - (57%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVFIALASNSLALKNEICGLPAAANG-----NCLALFSRW-SYDAQYNVCFNFIYGGCQGNENSF 66
            ::|||||..:....:|||.|...|||     :| |.:|.| ||.:..|.|..|.||||.||||.|
  Fly     7 YLFIALAGVNAESADEICQLTPEANGFGKIMSC-AHYSNWFSYHSDKNECLEFSYGGCGGNENRF 70

  Fly    67 ESQEECINKC 76
            :::..|.:.|
  Fly    71 QTKAICEDLC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 24/56 (43%)
CG42464NP_001162863.1 Kunitz_SCI-I-like 23..80 CDD:438677 25/57 (44%)

Return to query results.
Submit another query.