DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Wfdc8

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001400645.1 Gene:Wfdc8 / 685170 RGDID:1597713 Length:272 Species:Rattus norvegicus


Alignment Length:55 Identity:24/55 - (43%)
Similarity:33/55 - (60%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |.|.||:.| |||....:.|.:|:|.:.|..|.|.||.||.|:|.|:.:|.|.|:
  Rat   119 EPCLLPSDA-GNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNACM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 22/50 (44%)
Wfdc8NP_001400645.1 WAP 73..116 CDD:459672
Kunitz-type 121..171 CDD:438633 22/50 (44%)
WAP 176..216 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.