DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Eppin

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001102927.1 Gene:Eppin / 685161 RGDID:1597722 Length:134 Species:Rattus norvegicus


Alignment Length:56 Identity:28/56 - (50%)
Similarity:36/56 - (64%) Gaps:1/56 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :.:||.|| ..:|.|:|.|.||.|:.:...|..|||||||||.|:|:||..|.|.|
  Rat    73 QQDICSLP-KDSGYCMAYFPRWWYNKKNGTCQLFIYGGCQGNNNNFQSQSICQNAC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 26/50 (52%)
EppinNP_001102927.1 WAP 30..72 CDD:459672
Kunitz_eppin 75..131 CDD:438654 28/54 (52%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 17/26 (65%)
Interaction with LTF. /evidence=ECO:0000250 117..133 6/11 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.