powered by:
Protein Alignment Acp24A4 and Wfdc6a
DIOPT Version :9
Sequence 1: | NP_001036330.1 |
Gene: | Acp24A4 / 318936 |
FlyBaseID: | FBgn0051779 |
Length: | 78 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001233212.2 |
Gene: | Wfdc6a / 685153 |
RGDID: | 1597730 |
Length: | 146 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 29/67 - (43%) |
Similarity: | 38/67 - (56%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 FIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECIN 74
|.:.....:.|:.:||.||..| |.|||...||.|:....:|..|||||||||.|:|:|:..|..
Rat 72 FFSCGKKCMDLREDICSLPQDA-GPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTV 135
Fly 75 KC 76
.|
Rat 136 VC 137
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1474897at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.820 |
|
Return to query results.
Submit another query.