DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and SPINT1

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:64 Identity:25/64 - (39%)
Similarity:33/64 - (51%) Gaps:14/64 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            ||||.:              |.|...|.||.||....:|.:|:||||.||:|::..:||||..|
Human   251 LASNKV--------------GRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 20/50 (40%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 25/64 (39%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.