DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and Aplp2

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	NP_037038.1	Gene:	Aplp2 / 64312	RGDID:	2128	Length:	765	Species:	Rattus norvegicus

Alignment Length:	47	Identity:	22/47 - (46%)
Similarity:	28/47 - (59%)	Gaps:	0/47 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 AANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |..|.|.|:..||.:|.....|..||||||.||.|:|||::.|:..|
  Rat   316 AMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC 362

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	22/47 (47%)
Aplp2	NP_037038.1	A4_EXTRA	42..204	CDD:128326
		GFLD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	46..139
		APP_N	49..147	CDD:280358
		CuBD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	147..205
		APP_Cu_bd	149..204	CDD:289676
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	211..301
		Kunitz_BPTI	311..363	CDD:278443	22/47 (47%)
		APP_E2	367..549	CDD:289677
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	597..616
		APP_amyloid	711..761	CDD:287486
		Interaction with DAB2. /evidence=ECO:0000250	751..765
		NPXY motif	752..757
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810