DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Spint5

DIOPT Version :10

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001035144.1 Gene:Spint5 / 641368 MGIID:3651687 Length:105 Species:Mus musculus


Alignment Length:63 Identity:21/63 - (33%)
Similarity:34/63 - (53%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |..|..|..||..| ...|.|...|.|:.::.:..:|.:||:.||.||.|:|:::..|..:|:
Mouse    39 SGHLGAKRIICNQP-VKKGFCSFTFYRYYFNPESALCESFIFTGCGGNRNNFKTKYLCEVRCI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 16/50 (32%)
Spint5NP_001035144.1 Kunitz-type 49..99 CDD:438633 16/50 (32%)

Return to query results.
Submit another query.