DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and Spint5

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001035144.1 Gene:Spint5 / 641368 MGIID:3651687 Length:105 Species:Mus musculus


Alignment Length:63 Identity:21/63 - (33%)
Similarity:34/63 - (53%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCV 77
            |..|..|..||..| ...|.|...|.|:.::.:..:|.:||:.||.||.|:|:::..|..:|:
Mouse    39 SGHLGAKRIICNQP-VKKGFCSFTFYRYYFNPESALCESFIFTGCGGNRNNFKTKYLCEVRCI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 17/52 (33%)
Spint5NP_001035144.1 KU 48..99 CDD:197529 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.