DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and EPPIN

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_065131.1 Gene:EPPIN / 57119 HGNCID:15932 Length:133 Species:Homo sapiens


Alignment Length:59 Identity:29/59 - (49%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.||.::|.:| ...|.|||.|..|.||.:.|.|..|:|||||||.|:|:|:..|:|.|
Human    70 LDLKQDVCEMP-KETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 26/53 (49%)
EPPINNP_065131.1 WAP 30..70 CDD:306578 29/59 (49%)
Kunitz_BPTI 76..128 CDD:278443 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1474897at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - mtm8563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5063
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.