powered by:
Protein Alignment Acp24A4 and EPPIN
DIOPT Version :9
Sequence 1: | NP_001036330.1 |
Gene: | Acp24A4 / 318936 |
FlyBaseID: | FBgn0051779 |
Length: | 78 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_065131.1 |
Gene: | EPPIN / 57119 |
HGNCID: | 15932 |
Length: | 133 |
Species: | Homo sapiens |
Alignment Length: | 59 |
Identity: | 29/59 - (49%) |
Similarity: | 38/59 - (64%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
|.||.::|.:| ...|.|||.|..|.||.:.|.|..|:|||||||.|:|:|:..|:|.|
Human 70 LDLKQDVCEMP-KETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTC 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
51 |
1.000 |
Inparanoid score |
I5463 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1474897at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8563 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5063 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.900 |
|
Return to query results.
Submit another query.