DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and wfikkn2a

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_693394.5 Gene:wfikkn2a / 564992 ZFINID:ZDB-GENE-120914-1 Length:573 Species:Danio rerio


Alignment Length:52 Identity:25/52 - (48%)
Similarity:31/52 - (59%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |.|| :..|.|.|...||:|......|.:|:||||.||||:|||:|.|...|
Zfish   383 CSLP-SVQGPCKAYKPRWAYSHALKKCQSFVYGGCGGNENNFESKEACEEMC 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 25/52 (48%)
wfikkn2aXP_693394.5 WAP 43..89 CDD:278522
KAZAL_FS 137..173 CDD:238052
I-set 209..303 CDD:254352
Ig 223..303 CDD:299845
KU 325..375 CDD:197529
Kunitz_BPTI 382..433 CDD:278443 24/50 (48%)
NTR_WFIKKN 451..559 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.