DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and col6a4a

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:XP_017207020.1 Gene:col6a4a / 564005 ZFINID:ZDB-GENE-041111-303 Length:2568 Species:Danio rerio


Alignment Length:60 Identity:25/60 - (41%)
Similarity:33/60 - (55%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKCVE 78
            ||.|:.| |.....|.|......|.||.|.|.|..|.:|||:||:|.||::.||...|::
Zfish  2505 ALFNDAC-LMKQDVGPCSNYVLSWYYDIQQNECSQFWFGGCEGNKNRFETRAECEALCLK 2563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 21/52 (40%)
col6a4aXP_017207020.1 vWA_collagen 35..198 CDD:238749
VWA 230..>362 CDD:278519
VWA 416..588 CDD:278519
VWA 622..784 CDD:278519
VWA 807..975 CDD:278519
VWA 995..1164 CDD:278519
vWA_collagen 1184..1351 CDD:238749
VWA <1451..1548 CDD:214621
Collagen 1584..1676 CDD:189968
Collagen 1659..1739 CDD:189968
Collagen 1786..1840 CDD:189968
Collagen 1842..1912 CDD:189968
VWA 1943..2107 CDD:278519
VWA 2153..2325 CDD:278519
Kunitz_BPTI 2438..2490 CDD:278443
Kunitz_BPTI 2510..2561 CDD:278443 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.