DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and paplnb

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001018400.1 Gene:paplnb / 553586 ZFINID:ZDB-GENE-030131-6023 Length:548 Species:Danio rerio


Alignment Length:53 Identity:21/53 - (39%)
Similarity:27/53 - (50%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            :|.| |...|.|....||:.:|.....|..|.:||||||.|:|.|:..|...|
Zfish   470 VCSL-ARDVGPCYEYKSRFYFDHSSGSCSQFWFGGCQGNGNNFVSKVACERTC 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 21/53 (40%)
paplnbNP_001018400.1 TSP1 28..78 CDD:214559
TSP1 249..300 CDD:214559
TSP1 309..359 CDD:214559
Kunitz_BPTI 470..522 CDD:278443 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.