DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acp24A4 and App

DIOPT Version :9

Sequence 1:	NP_001036330.1	Gene:	Acp24A4 / 318936	FlyBaseID:	FBgn0051779	Length:	78	Species:	Drosophila melanogaster
Sequence 2:	NP_062161.1	Gene:	App / 54226	RGDID:	2139	Length:	770	Species:	Rattus norvegicus

Alignment Length:	54	Identity:	23/54 - (42%)
Similarity:	31/54 - (57%)	Gaps:	1/54 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |:|. ..|..|.|.|:.|||.:|.....|..|.||||.||.|:|:::|.|:..|
  Rat   289 EVCS-EQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVC 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acp24A4	NP_001036330.1	Kunitz_BPTI	24..77	CDD:278443	22/53 (42%)
App	NP_062161.1	A4_EXTRA	24..188	CDD:128326
		GFLD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	28..123
		Heparin-binding. /evidence=ECO:0000250\|UniProtKB:P05067	96..110
		CuBD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	131..189
		Copper-binding. /evidence=ECO:0000250	135..155
		Zinc-binding. /evidence=ECO:0000250	181..188
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	196..283
		Kunitz_BPTI	294..341	CDD:333766	20/46 (43%)
		OX-2. /evidence=ECO:0000250\|UniProtKB:P05067	344..365
		APP_E2	366..548	CDD:372388
		Heparin-binding. /evidence=ECO:0000250	391..423
		Heparin-binding. /evidence=ECO:0000250	491..522
		Collagen-binding. /evidence=ECO:0000250\|UniProtKB:P05067	523..540
		Beta-APP	677..713	CDD:367525
		Interaction with PSEN1. /evidence=ECO:0000250\|UniProtKB:P05067	695..722
		APP_amyloid	716..766	CDD:371108
		Basolateral sorting signal. /evidence=ECO:0000250	724..734
		Interaction with G(o)-alpha	732..751
		Required for the interaction with KIF5B and for anterograde transport in axons. /evidence=ECO:0000250\|UniProtKB:P05067	756..770
		YENPXY motif, contains endocytosis signal. /evidence=ECO:0000250\|UniProtKB:P05067	757..762
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810