DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp24A4 and app

DIOPT Version :9

Sequence 1:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_001005698.1 Gene:app / 448208 XenbaseID:XB-GENE-479154 Length:750 Species:Xenopus tropicalis


Alignment Length:54 Identity:24/54 - (44%)
Similarity:31/54 - (57%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
            |:|. ..|..|.|.|:..||.||.....|..||||||.||.|:|:|::.|:..|
 Frog   287 EVCS-EQAETGPCRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYCMAVC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 23/53 (43%)
appNP_001005698.1 A4_EXTRA 23..187 CDD:128326
Kunitz_BPTI 292..339 CDD:333766 21/46 (46%)
APP_E2 346..528 CDD:372388
Beta-APP 657..693 CDD:367525
APP_amyloid 696..746 CDD:371108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.